Teriparatide
Also known as: PTH(1-34), Forteo
A recombinant PTH(1-34) peptide that stimulates bone formation; FDA-approved for osteoporosis and used to accelerate fracture healing.
Research Status
FDA-approved
For research purposes only. Not approved for human use. Not medical advice.
Research Areas
Side Effects
Occurs in up to 30% of users. Usually resolves within hours to days. Minimize by allowing solution to reach room temperature, rotating sites, and using proper injection technique. Apply ice if needed.
Serum calcium rises 1-2 hours post-injection and normalizes within 4-6 hours. More pronounced in patients with high baseline calcium or vitamin D levels. Monitor serum calcium at baseline and periodically during treatment.
Reported in 8-13% of users, typically mild and transient. Usually occurs within 30 minutes of injection and resolves within 1-2 hours. May be reduced by injecting in the evening or with food.
Occurs in 5-7% of users, particularly within 30 minutes of injection. Sit or lie down during injection if prone to dizziness. Usually resolves quickly.
Reported in 5-6% of users. Generally mild and self-resolving. May be related to transient hypercalcemia.
Reported in 3-5% of users. May be related to electrolyte shifts or increased bone turnover. Ensure adequate hydration and electrolyte intake.
Teriparatide increases serum uric acid due to increased bone turnover. Patients with history of gout should be monitored. Urate-lowering therapy may be needed.
Increased urinary calcium excretion may occur. Patients with history of nephrolithiasis should maintain adequate hydration and may require monitoring of 24-hour urinary calcium.
Osteosarcoma was observed in rats receiving high-dose teriparatide for 2 years. No cases have been confirmed in humans during clinical trials or post-marketing surveillance. FDA recommends limiting treatment to 24 months and avoiding use in patients with open epiphyses, prior radiation therapy, or elevated baseline alkaline phosphatase.
Serum phosphate may rise transiently post-injection. Normalizes within 4-6 hours. Clinically insignificant in most patients with normal renal function.
Hypersensitivity reactions including rash, urticaria, or anaphylaxis are extremely rare. Discontinue immediately and seek medical attention if symptoms occur.
Dosing Reference
| Parameter | Value |
|---|---|
| Dose range | 20 mcg |
| Frequency | 1x daily |
| Timing | Consistent time each day; evening dosing may reduce hypercalcemia risk |
| Route | Subcutaneous |
FDA-approved dose is 20 mcg once daily via subcutaneous injection. Maximum recommended duration is 24 months due to osteosarcoma risk in animal studies. For research purposes only.
Research disclaimer
Figures drawn from published research literature and community logs. Not clinical recommendations. Consult a qualified professional. Research use only.
Reconstitution Guide
Do not use saline or bacteriostatic saline — use only bacteriostatic water for reconstitution
Do not shake the vial vigorously; gentle swirling prevents peptide degradation
Discard immediately if the solution appears cloudy, discolored, or contains visible particles
Use within 30 days of reconstitution when stored at 2–8°C
Do not freeze the reconstituted solution; freezing may denature the peptide
Use the PeptideVolt reconstitution calculator for your exact concentration
Molecular and Pharmacological Data
| Molecular weight | 4117 |
| Half-life | 1 hour (serum); bone effects persist 24+ hours |
| Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKQMAVKKYLUHF |
Teriparatide is a recombinant human parathyroid hormone (PTH) analog containing the first 34 amino acids of endogenous PTH. It binds to PTH1 receptors on osteoblasts, stimulating bone formation and increasing bone mineral density. Unlike continuous PTH exposure (which promotes bone resorption), intermittent daily injections of teriparatide preferentially activate osteoblasts and promote net bone formation, making it unique among osteoporosis treatments.
PTH1 Receptor Signaling
Teriparatide binds to PTH1 receptors on osteoblasts, activating Gs-coupled G-protein signaling that increases intracellular cAMP and calcium, leading to osteoblast proliferation and differentiation
Wnt/β-Catenin Pathway
PTH signaling inhibits sclerostin (an osteocyte-derived Wnt antagonist), allowing canonical Wnt signaling to proceed and promote osteoblast differentiation and bone formation
IGF-1 and FGF Upregulation
PTH stimulates osteoblasts to increase local production of insulin-like growth factor-1 (IGF-1) and fibroblast growth factor (FGF), which enhance bone cell proliferation and matrix synthesis
Calcium and Phosphate Homeostasis
PTH increases renal reabsorption of calcium and promotes conversion of 25-hydroxyvitamin D to active 1,25-dihydroxyvitamin D, enhancing intestinal calcium absorption
- Teriparatide is the only FDA-approved anabolic agent for osteoporosis; all others are antiresorptive
- Intermittent dosing (once daily) promotes bone formation; continuous exposure would promote resorption
- Increases bone mineral density in spine, hip, and non-spine sites within 6-12 months
- Reduces vertebral fracture risk by approximately 65% and non-vertebral fracture risk by 53% in postmenopausal women
- Effects on bone are reversible; bone mineral density declines after discontinuation unless followed by antiresorptive therapy
- Serum calcium and phosphate levels rise transiently; monitoring is recommended, especially in patients with renal impairment
Track your Teriparatide research
Free account. No credit card required.
Browse the Research Library
40+ peptide profiles with mechanism summaries, dosing data, and reconstitution guides.
View all peptidesResearch Use Only. All content on this page is provided for informational and educational purposes related to scientific research. Teriparatide is not approved for human use by the FDA or any equivalent regulatory body. This is not medical advice. Do not use any substance discussed here for therapeutic, diagnostic, or preventative purposes. Consult a qualified healthcare professional before making any health-related decisions. The Peptide Volt does not endorse the use of any research chemicals. 18+ only.