Exenatide
Also known as: Byetta, Bydureon
Exenatide is the first GLP-1 receptor agonist approved by the FDA. Based on exendin-4 from Gila monster saliva, it is available as twice-daily or once-weekly formulation for type 2 diabetes and weight management.
Research Status
FDA-approved for type 2 diabetes
For research purposes only. Not approved for human use. Not medical advice.
Research Areas
Side Effects
Most common side effect, especially during the first 1-2 weeks of treatment. Usually resolves with continued use as the body adapts. Occurs in 40-50% of users. Manage by taking doses with food, staying hydrated, and eating small, frequent meals. Antiemetics (e.g., ginger, vitamin B6) may help.
Occurs in 5-10% of users, typically early in treatment. If severe or persistent, contact a healthcare provider. May indicate need for dose adjustment or temporary discontinuation.
Occurs in 5-10% of users. Usually self-resolving within days to weeks. Manage with adequate hydration and dietary fiber. Avoid high-fat foods which may exacerbate symptoms.
Occurs in 5-10% of users. Manage with increased water intake, dietary fiber, and physical activity. Stool softeners may be used if needed.
Occurs in 5-10% of users. Usually mild and self-resolving. Over-the-counter analgesics (acetaminophen, ibuprofen) may be used if needed.
Occurs in 5-10% of users, particularly if blood glucose drops rapidly. Ensure adequate carbohydrate intake and monitor blood glucose regularly. Rise slowly from sitting or lying positions.
Risk is increased when exenatide is combined with insulin or sulfonylureas. Symptoms include tremor, sweating, palpitations, anxiety, confusion, and loss of consciousness. Always carry fast-acting carbohydrates (glucose tablets, juice). Requires immediate medical attention if severe. Dose adjustment of concurrent medications may be necessary.
Redness, swelling, or itching at injection site occurs in 5-10% of users. Manage by rotating injection sites, using proper injection technique, and allowing the solution to reach room temperature before injection. Topical antihistamines may help itching.
Occurs with repeated injections in the same area. Prevent by rotating injection sites systematically and maintaining at least 1 inch between injection points. This is a cosmetic concern but can affect absorption if severe.
Rare but serious adverse event reported in clinical trials and post-marketing surveillance. Symptoms include severe upper abdominal pain, back pain, nausea, and vomiting. Requires immediate emergency medical evaluation. Discontinue exenatide immediately if pancreatitis is suspected. History of pancreatitis is a relative contraindication.
Animal studies showed dose-dependent thyroid C-cell proliferation and medullary thyroid carcinoma at high doses. Clinical relevance in humans is unclear, but exenatide is contraindicated in patients with personal or family history of medullary thyroid carcinoma or multiple endocrine neoplasia type 2 (MEN2).
Rare cases reported, particularly in patients with pre-existing renal impairment or severe dehydration. Monitor renal function and ensure adequate hydration. Use with caution in patients with eGFR <30 mL/min/1.73m².
Rare but serious. Symptoms include rash, urticaria, angioedema, dyspnea, and anaphylaxis. Requires immediate emergency medical attention. Discontinue exenatide immediately if allergic reaction occurs.
Exenatide slows gastric emptying as part of its mechanism, but severe gastroparesis is rare. Symptoms include persistent nausea, vomiting, and abdominal bloating. Monitor for worsening GI symptoms; dose adjustment or discontinuation may be necessary.
Intentional effect of exenatide that contributes to weight loss. However, excessive appetite suppression may lead to inadequate caloric intake. Ensure balanced nutrition and monitor for signs of malnutrition.
Dosing Reference
| Parameter | Value |
|---|---|
| Dose range | 5-10 mcg (twice daily) or 2 mg (weekly) |
| Frequency | Twice daily or once weekly |
| Timing | Before meals (short-acting) |
| Route | Subcutaneous |
First GLP-1 agonist. Take before meals for short-acting formulation.
Research disclaimer
Figures drawn from published research literature and community logs. Not clinical recommendations. Consult a qualified professional. Research use only.
Reconstitution Guide
Do not use saline or bacteriostatic saline — use only bacteriostatic water for reconstitution
Do not shake the vial vigorously; gentle swirling prevents peptide degradation
Discard immediately if the solution appears cloudy, discolored, or contains visible particles
Use within 30 days of reconstitution when stored at 2–8°C
Do not freeze the reconstituted solution; freezing may denature the peptide
Use the PeptideVolt reconstitution calculator for your exact concentration
Molecular and Pharmacological Data
| Molecular weight | 4186 Da |
| Half-life | 2.4 hours (short-acting); 7 days (extended-release weekly formulation) |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
Exenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that mimics the natural hormone GLP-1, which regulates blood glucose and appetite. It works by stimulating insulin secretion in response to elevated blood glucose, slowing gastric emptying to reduce postprandial glucose spikes, and promoting satiety through central nervous system signaling. These combined effects improve glycemic control and reduce body weight in patients with type 2 diabetes and obesity.
GLP-1 Receptor Activation
Exenatide binds to GLP-1 receptors on pancreatic beta cells, triggering glucose-dependent insulin secretion. This mechanism is glucose-sensitive, meaning insulin is released only when blood glucose is elevated, reducing hypoglycemia risk.
Gastric Emptying Inhibition
Exenatide slows the rate at which food moves from the stomach into the small intestine, reducing the postprandial glucose spike and promoting satiety, which contributes to weight loss.
Appetite Suppression
GLP-1 receptor activation in the hypothalamus and other central nervous system regions increases feelings of fullness and reduces hunger signals, leading to decreased caloric intake.
Glucagon Suppression
Exenatide inhibits glucagon secretion when blood glucose is low, preventing inappropriate glucose production by the liver and further reducing hypoglycemia risk.
- Exenatide is derived from exendin-4, a peptide found in Gila monster saliva, and was the first GLP-1 receptor agonist approved by the FDA (2005)
- Unlike insulin, exenatide only stimulates insulin secretion when blood glucose is elevated, making it glucose-dependent and reducing hypoglycemia risk
- The short-acting formulation (5-10 mcg twice daily) has a rapid onset and is taken before meals; the extended-release formulation (2 mg weekly) provides consistent plasma levels
- Exenatide has demonstrated cardiovascular benefits in clinical trials, including reduced risk of major adverse cardiovascular events in high-risk patients
Track your Exenatide research
Free account. No credit card required.
Browse the Research Library
40+ peptide profiles with mechanism summaries, dosing data, and reconstitution guides.
View all peptidesResearch Use Only. All content on this page is provided for informational and educational purposes related to scientific research. Exenatide is not approved for human use by the FDA or any equivalent regulatory body. This is not medical advice. Do not use any substance discussed here for therapeutic, diagnostic, or preventative purposes. Consult a qualified healthcare professional before making any health-related decisions. The Peptide Volt does not endorse the use of any research chemicals. 18+ only.